PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM10G00200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 248aa    MW: 27249.7 Da    PI: 8.057
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM10G00200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.7e-1893147256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ +++keq   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  OGLUM10G00200.1  93 RKKLRLSKEQSALLEDRFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTK 147
                      788899***********************************************98 PP

2HD-ZIP_I/II125.82e-4093181190
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                      +kk+rlskeq++lLE+ F+e+++L+p++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e Lkr++++l+een+rL++e ++Lr +
  OGLUM10G00200.1  93 RKKLRLSKEQSALLEDRFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCELLKRCCETLTEENRRLHRELQQLR-A 181
                      69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.3E-1880150IPR009057Homeodomain-like
PROSITE profilePS5007117.00689149IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-1791152IPR009057Homeodomain-like
SMARTSM003892.1E-1591153IPR001356Homeobox domain
CDDcd000864.33E-1593150No hitNo description
PfamPF000462.4E-1593147IPR001356Homeobox domain
PROSITE patternPS000270124147IPR017970Homeobox, conserved site
PfamPF021831.5E-10149182IPR003106Leucine zipper, homeobox-associated
SMARTSM003407.0E-21149192IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MAQDDEDVGL ALGLSLGSGG HRRQRESRDE APSSAAASLL TLRLPAESGG QPQVVVKREV  60
VRAEEEEYEY EYERALYSSS AAAADDDEGC NSRKKLRLSK EQSALLEDRF KEHSTLNPKQ  120
KVALAKQLNL RPRQVEVWFQ NRRARTKLKQ TEVDCELLKR CCETLTEENR RLHRELQQLR  180
ALTHSTAAGF FMATTLPVPA ATLSICPSCE RLATAAAAAG ASPTAAADRT NKPTAPHLFS  240
PFAKSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19197SRKKLRL
2141149RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0693240.0AC069324.3 Oryza sativa Japonica Group chromosome 10 clone OSJNBa0071K19, complete sequence.
GenBankAC0994000.0AC099400.2 Oryza sativa Japonica Group chromosome 10 clone OSJNBa0096E22, complete sequence.
GenBankAC1451270.0AC145127.1 Oryza sativa Japonica Group chromosome 10 clone Pseudo10p0.0-10p4.4, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612921.11e-142PREDICTED: homeobox-leucine zipper protein HOX15
SwissprotA2Z4C40.0HOX15_ORYSI; Homeobox-leucine zipper protein HOX15
TrEMBLA0A0E0B7220.0A0A0E0B722_9ORYZ; Uncharacterized protein
STRINGBGIOSGA032409-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-59homeobox from Arabidopsis thaliana